PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA02G06890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CO-like
Protein Properties Length: 349aa    MW: 35766.2 Da    PI: 6.658
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA02G06890.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.89e-0859104342
         zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                       ++C+ +e  ++   C+ +   lC+ C + +H        H++vp+
  ONIVA02G06890.1  59 VWVCEVCELAPAAVTCKADAAALCAACDSDIHDAnplarrHERVPV 104
                      689*****************************44788888999986 PP

2CCT69.58.6e-24281324144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      R+a+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpRvKGrF+k+a
  ONIVA02G06890.1 281 RAARLMRYREKRKNRRFEKTIRYASRKAYAETRPRVKGRFAKRA 324
                      99****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.041361IPR000315B-box-type zinc finger
PROSITE profilePS5011910.60857104IPR000315B-box-type zinc finger
PfamPF006431.4E-558104IPR000315B-box-type zinc finger
SMARTSM003362.8E-862104IPR000315B-box-type zinc finger
PROSITE profilePS5101716.807281323IPR010402CCT domain
PfamPF062031.0E-17281323IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MEMELGLGRY WGVGGRRCGA CAVAPAAVHC RTCDGGGGGG GYLCAGCDAE HGRAGHERVW  60
VCEVCELAPA AVTCKADAAA LCAACDSDIH DANPLARRHE RVPVHPIGSS AAPPPDALLL  120
GGENDAAAAV DGGGGGKEVK LDFLFADFMD PYLGGSPELA RFPHADSVVP NHNGSAGPAM  180
ELGFAGGGGA AVKPSYSSYT AASLGNSGSS SEVGLVPDAI CGGGGGGIIE LDFAQSKAAY  240
LPYASTPSHS MSSSMDMGVA APEMSDGAAA AAGRAYAAEG RAARLMRYRE KRKNRRFEKT  300
IRYASRKAYA ETRPRVKGRF AKRADDHDAA APPPQIMLDF AGYGVVPTF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096300.0AK109630.1 Oryza sativa Japonica Group cDNA clone:002-138-D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623284.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 3
TrEMBLA0A0E0G2G40.0A0A0E0G2G4_ORYNI; Uncharacterized protein
STRINGBGIOSGA007657-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.15e-23CONSTANS-like 3